PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family NF-YB
Protein Properties Length: 194aa    MW: 20990.4 Da    PI: 6.6795
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.58.3e-5822117297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+++re+ege
  XP_004491514.1  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQRFREIEGE 116
                     89********************************************************************************************9 PP

           NF-YB  97 k 97 
                     k
  XP_004491514.1 117 K 117
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-5417130IPR009072Histone-fold
SuperFamilySSF471132.33E-4024126IPR009072Histone-fold
PfamPF008085.5E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.6E-215573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.6E-217492No hitNo description
PRINTSPR006159.6E-2193111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MADSDNESGG TQNAGNSELS PREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKIYLQRF REIEGEKTVA  120
AARDKDVAPP SSSSSSVYDY GASQVGMIMH HQHQGHVYGS GGFHQVPVTG SPVMGNKGGG  180
PGYPNPGSNA GRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B5e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1221651e-149AC122165.40 Medicago truncatula clone mth2-32m22, complete sequence.
GenBankBT1413111e-149BT141311.1 Medicago truncatula clone JCVI-FLMt-8O17 unknown mRNA.
GenBankJQ9182901e-149JQ918290.1 Medicago truncatula nuclear transcription factor Y subunit B17 (NF-YB17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491514.11e-145PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233109e-76NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLG7K4Q51e-115G7K4Q5_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA18G08620.11e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.18e-77nuclear factor Y, subunit B3